PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010535528.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family MYB_related
Protein Properties Length: 261aa    MW: 29165.6 Da    PI: 8.3442
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010535528.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.23.4e-1764109148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T++E+ l ++++ ++G++ W++Iar+++ gRt++++k++w++++
   XP_010535528.1  64 RGKMTPQEERLVLELHVKWGNR-WSKIARKLP-GRTDNEIKNYWRTHM 109
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500905.0182058IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.603.0E-94470IPR009057Homeodomain-like
SuperFamilySSF466897.52E-2244114IPR009057Homeodomain-like
PROSITE profilePS5129427.05359113IPR017930Myb domain
SMARTSM007171.2E-1663111IPR001005SANT/Myb domain
PfamPF002491.9E-1564108IPR001005SANT/Myb domain
CDDcd001671.50E-1266109No hitNo description
Gene3DG3DSA:1.10.10.604.9E-2071110IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009723Biological Processresponse to ethylene
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0010200Biological Processresponse to chitin
GO:0046686Biological Processresponse to cadmium ion
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 261 aa     Download sequence    Send to blast
MGFYCQSFRF EGGGRSIIGR LVLDMGGLWK GPSINDPSFV VGLNRTGKSC RLRWGNYLHP  60
GLKRGKMTPQ EERLVLELHV KWGNRWSKIA RKLPGRTDNE IKNYWRTHMR KKAQEKKRSM  120
SRTSSSSNCC SSTATTATTQ DSLQSPDSGS GKASFYDTGG FDGKLNQEVE DCEGGYSMDD  180
IWKEIDQSEA SILKPVIDIY AEQSCYLNYP PLASPAWESS LDSIWNMEAD ESKMSFAIDQ  240
FPHYSGYVRS SSSSPSSSLA G
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A2e-184511337105MYB PROTO-ONCOGENE PROTEIN
1h88_C6e-184511391159MYB PROTO-ONCOGENE PROTEIN
1h89_C6e-184511391159MYB PROTO-ONCOGENE PROTEIN
1h8a_C3e-184511360128MYB TRANSFORMING PROTEIN
1mse_C2e-184511337105C-Myb DNA-Binding Domain
1msf_C2e-184511337105C-Myb DNA-Binding Domain
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00600PBMTransfer from AT5G59780Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2290487e-99AK229048.1 Arabidopsis thaliana mRNA for MYB27 protein - like, complete cds, clone: RAFL16-34-F17.
GenBankDQ0752527e-99DQ075252.1 Arabidopsis thaliana MYB transcription factor MYB59-1 (At5g59780) mRNA, complete cds, alternatively spliced.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010535527.10.0PREDICTED: transcription factor MYB59 isoform X2
RefseqXP_010535528.10.0PREDICTED: transcription factor MYB59 isoform X3
SwissprotQ4JL842e-97MYB59_ARATH; Transcription factor MYB59
TrEMBLA0A0D3B2J61e-104A0A0D3B2J6_BRAOL; Uncharacterized protein
STRINGBra006694.1-P1e-97(Brassica rapa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59780.24e-98myb domain protein 59